Ghost Stories of an AntiquaryJames, M. R. (Montague Rhodes)
General
Ghost Stories of an Antiquary
James, M. R. (Montague Rhodes)
Ghost stories, English; Horror tales, English; Short stories, English
“Do you see it? ‘_Decem millia auri reposita sunt in puteo in at_. . .’
(Ten thousand [pieces] of gold are laid up in a well in …), followed by
an incomplete word beginning _at_. So far so good. I tried the same
plan with the remaining letters; but it wouldn’t work, and I fancied
that perhaps the placing of dots after the three last letters might
indicate some difference of procedure. Then I thought to myself,
‘Wasn’t there some allusion to a well in the account of Abbot Thomas in
that book the “_Sertum_”?’ Yes, there was: he built a _puteus in atrio_
(a well in the court). There, of course, was my word _atrio_. The next
step was to copy out the remaining letters of the inscription, omitting
those I had already used. That gave what you will see on this slip:
RVIIOPDOOSMVVISCAVBSBTAOTDIEAMLSIVSPDEERSETAEGIANRFEEALQDVAIMLEATTHOOVM
CA.H.Q.E.
“Now, I knew what the three first letters I wanted were—namely,
_rio_—to complete the word _atrio_; and, as you will see, these are all
to be found in the first five letters. I was a little confused at first
by the occurrence of two _i’s_, but very soon I saw that every
alternate letter must be taken in the remainder of the inscription. You
can work it out for yourself; the result, continuing where the first
‘round’ left off, is this:
‘_rio domus abbatialis de Steinfeld a me, Thoma, qui posui custodem
super ea. Gare à qui la touche_’.
“So the whole secret was out:
‘Ten thousand pieces of gold are laid up in the well in the court of
the Abbot’s house of Steinfeld by me, Thomas, who have set a guardian
over them. _Gare à qui la touche_.’
“The last words, I ought to say, are a device which Abbot Thomas had
adopted. I found it with his arms in another piece of glass at Lord
D——’s, and he drafted it bodily into his cipher, though it doesn’t
quite fit in point of grammar.
“Well, what would any human being have been tempted to do, my dear
Gregory, in my place? Could he have helped setting off, as I did, to
Steinfeld, and tracing the secret literally to the fountain-head? I
don’t believe he could. Anyhow, I couldn’t, and, as I needn’t tell you,
I found myself at Steinfeld as soon as the resources of civilization
could put me there, and installed myself in the inn you saw. I must
tell you that I was not altogether free from forebodings—on one hand of
disappointment, on the other of danger. There was always the
possibility that Abbot Thomas’s well might have been wholly
obliterated, or else that someone, ignorant of cryptograms, and guided
only by luck, might have stumbled on the treasure before me. And
then”—there was a very perceptible shaking of the voice here—’I was not
entirely easy, I need not mind confessing, as to the meaning of the
words about the guardian of the treasure. But, if you don’t mind, I’ll
say no more about that until—until it becomes necessary.
Public-domain text, read in full here on John Shaqi.
Reviews
Reviews
No reviews yet
Be the first to share your thoughts on this work.
Elsewhere in the archive
Join the Discussion
Join the discussion
Sign in to leave a comment or review.
Sign InorCreate an account